What powers ectacenter.org?

Last seen Jun 2026 · 13 technologies across 11 categories

Analytics

Google Analytics
since Aug 2018

CDN

cdnjs
since Nov 2021
Cloudflare
since May 2022
jQuery CDN
since Feb 2022

Font scripts

Font Awesome v5.10.2
since Feb 2020

JavaScript libraries

jQuery v3.3.1
since Aug 2018

Miscellaneous

Open Graph
since Aug 2024

Operating systems

Windows Server
since Aug 2018

Tag managers

Google Tag Manager
since Aug 2018

UI frameworks

Bootstrap v4.3.1
since Aug 2018

Video players

YouTube
since Aug 2018

Web frameworks

Microsoft ASP.NET
since Aug 2018

Web servers

IIS v10.0
since Aug 2018

Top search keywords

KeywordPositionEst. monthly visits
dec #7 3,500
ecta #1 880
dayc #8 650
what does idea stand for #2 390
sde ok #9 270
osep #3 230
individualized education program #37 230
individualized education plan #46 230
p cycle #14 150
cor advantage #6 150
cor advantage #6 150
help assessment #1 120
ece conference #2 120
idea education #9 99
annual performance report #38 95
capta #8 87
early childhood education journal #3 86
idea part d #1 79
idea part b #5 61
what is individualized education program #53 47
idea act #27 47
definition inclusion #30 47
battelle developmental inventory 2 pdf #1 43
child development #71 43
cos form #1 43

The site's top keywords in Google (US), with the visits each one is estimated to bring per month.

Top backlinks

FromAnchor text
eiexcellence.org Seven Key Principles: Looks Like / Doesn’t Look Like
medbridgeeducation.com http://www.ectacenter.org/~pdfs/topics/families/Principles_LooksLike_DoesntLookL
medbridge.com http://www.ectacenter.org/~pdfs/topics/families/Principles_LooksLike_DoesntLookL
coach2coach.staceylandberg.com http://www.ectacenter.org/~pdfs/topics/families/Principles_LooksLike_DoesntLookL
inte.asha.org http://www.ectacenter.org/~pdfs/topics/families/Principles_LooksLike_DoesntLookL
kidscarehomehealth.com PDF
dev.militaryfamilieslearningnetwork.org [3]
oneop.org [3]
kskits.org Determining LRE Placements for Preschool Children with Disabilities: Reference P
asha.org http://www.ectacenter.org/~pdfs/topics/families/Principles_LooksLike_DoesntLookL
primeirosanos.iscte-iul.pt http://www.ectacenter.org/~pdfs/topics/families/Principles_LooksLike_DoesntLookL
kdhe.ks.gov Seven Key Principles: Looks Like/Doesn't Look Like (PDF)
nature.com https://ectacenter.org/topics/earlyid/state-info.asp
theatlantic.com more than 427,000
cdc.gov The Importance of Early Intervention for Infants and Toddlers with Disabilities
buzzsprout.com https://ectacenter.org/
unicef.org Рекомендовані практики
healthline.com public early childhood assistance center
mass.gov Supporting Children and Families during the COVID-19 Pandemic
aap.org Early Childhood Technical Assistance Center
mdpi.com http://ectacenter.org/~pdfs/trohanis/trohanis_guiding_principles.pdf
psypost.org 40% of children
nationalacademies.org https://ectacenter.org/idea.asp
michigan.gov Tele-Intervention and Distance Learning
in.gov First Steps in Other States

Top links pointing at the site, one per source domain, strongest first. The anchor text opens the page carrying the link.

Audience

  • 89% desktop
  • 10% phone
  • United States

Countries where the site has Chrome traffic, strongest markets first.

Open Page Rank

6.74 / 10 · ranked #59,954 of all domains

462 referring domains · OpenPageRank

Search traffic

10,200 est. monthly organic visits (US)

2,391 keywords in Google's top 30

Core Web Vitals

LCP0.8 s
INP25 ms
CLS0.1
TTFB400 ms

Real user p75, Chrome UX Report, Jun 2026.

Page

  • Language: English
  • Weight: 2.1 MB · 59 requests
  • Structured data: OpenGraph

Homepage as crawled by the HTTP Archive, Jul 2026.

Full technology history →
Report an incorrect detection

Look up any website for free

No paywall, no lead-gen, no account. Paste a domain and see what powers it.

No account neededHistory since 2018