Technology history for kevinwilliamslandscapedesign.com

Stack size over time

From 4 detected technologies in Mar 2026 to 21 in May 2026.

Currently detected

Previously used

  • PHP Mar 2026 to Mar 2026 · 1 mo

Timeline

2026 18 added · 1 dropped

Look up any website for free

No paywall, no lead-gen, no account. Paste a domain and see what powers it.

No account neededHistory since 2018