Technology history for lakelanefishingandcampinggetaway.com

Stack size over time

From 7 detected technologies in Jul 2021 to 21 in Jun 2026 (peak 23).

Currently detected

Previously used

Timeline

2025 2 switched

2024 1 added

2023 5 dropped

2022 4 added

Look up any website for free

No paywall, no lead-gen, no account. Paste a domain and see what powers it.

No account neededHistory since 2018