Technology history for actividadesdeinfantilyprimaria.com

Stack size over time

From 5 detected technologies in Apr 2018 to 35 in Jun 2026 (peak 41).

Currently detected

Previously used

Timeline

2026 5 added · 8 dropped

2025 21 added · 6 dropped

2024 13 added · 12 dropped

2023 40 added · 18 dropped · 2 switched

2022 27 added · 7 dropped

2021 12 added · 7 dropped

2020 1 added · 2 dropped

2019 12 added · 3 dropped

2018 1 added

  • added AppNexus Jul 2018 · Advertising Networks

Look up any website for free

No paywall, no lead-gen, no account. Paste a domain and see what powers it.

No account neededHistory since 2018